Overview

  • Product name

    Anti-ZNF692 antibody
  • Description

    Rabbit polyclonal to ZNF692
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF692 aa 109-185.
    Sequence:

    GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELA DLESEHDERTQEARLPRRVGPPPETFP


    Database link: Q9BU19

  • Positive control

    • RT-4, U-251 MG, Human Plasma and Human Liver lysats; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 57 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AICAR responsive element binding protein antibody
    • AREBP antibody
    • Zfp692 antibody
    • Zfp692 ps antibody
    • Zinc finger protein 692 antibody
    • ZN692_HUMAN antibody
    • Znf692 antibody
    see all

Images

  • Immunofluorescent analysis of HeLa cells (PFA-fixed/Triton X-100 permeabilized) labeling ZNF692 with ab204595 at 4µg/ml (green). 

  • All lanes : Anti-ZNF692 antibody (ab204595) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate

    Predicted band size: 57 kDa

References

This product has been referenced in:

  • Zhu B  et al. A clinical, biologic and mechanistic analysis of the role of ZNF692 in cervical cancer. Gynecol Oncol N/A:N/A (2018). Read more (PubMed: 30466806) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up