Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF699
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF699 aa 19-195.
    Sequence:

    VVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGYPLHTPHLI SQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKIS NEQKIVRFKRNDSWFSSLHENQESCGIDYQNKSHERHLRNHMVENIYECY EENQDGQTFSQVPNLDSLKRNTEVKSC


    Database link: Q32M78

  • Positive control

    • WB: Jurkat, K562 and U-87 MG whole cell lysates. IHC-P: Human endometrial cancer and brain tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 73 kDa.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 16 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ38144 antibody
    • hang antibody
    • Hangover homolog antibody
    • hangover, Drosophila, homolog of antibody
    • MGC129880 antibody
    • MGC129881 antibody
    • Zinc finger protein 699 antibody
    • ZN699_HUMAN antibody
    • ZNF699 antibody
    see all

Images

  • All lanes : Anti-ZNF699 antibody (ab236099) at 1/500 dilution

    Lane 1 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 3 : U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 73 kDa

  • Paraffin-embedded human endometrial cancer tissue stained for ZNF699 with ab236099 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for ZNF699 with ab236099 at 1/100 dilution in immunohistochemical analysis.

References

ab236099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236099.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up