Overview

  • Product name

    Anti-ZNF703 antibody [CL0654]
    See all ZNF703 primary antibodies
  • Description

    Mouse monoclonal [CL0654] to ZNF703
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ZNF703 aa 156-216.
    Sequence:

    PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPH GAPVSASSSSS


    Database link: Q9H7S9

  • Positive control

    • Human breast carcinoma, colorectal adenocarcinoma, stomach, small intestine, rectum, placenta and liver tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Monoclonal
  • Clone number

    CL0654
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 58 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human breast carcinoma tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human breast carcinoma tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human colorectal carcinoma tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human stomach (ventricle cancer) tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver tissue, labeling ZNF703 using ab188031 at a 1/50 dilution.

  • All lanes : Anti-ZNF703 antibody [CL0654] (ab188031) at 1/500 dilution

    Lane 1 : Negative control (vector only transfected HEK293T cell lysate)
    Lane 2 : ZNF703 over-expression lysate (co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in HEK293 cells)

    Predicted band size: 58 kDa

References

ab188031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up