Overview

  • Product name

    Anti-ZNF85 antibody
  • Description

    Rabbit polyclonal to ZNF85
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF85 aa 68-246.
    Sequence:

    HKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKC TKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKAFNWSSTLTKHKRIHTG EKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTH KIIHTGEKPYKCKECGKAFNRSSTLTTHR


    Database link: Q49A12

  • Positive control

    • HeLa lysate; Human fetal testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 69 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    May be a transcriptional repressor.
  • Tissue specificity

    Widely expressed, including in testis.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 16 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HPF 4 antibody
    • HPF4 antibody
    • HTF 1 antibody
    • HTF1 antibody
    • MGC78566 antibody
    • Zinc finger protein 85 antibody
    • Zinc finger protein HPF4 antibody
    • Zinc finger protein HTF1 antibody
    • ZNF 85 antibody
    • ZNF85 antibody
    • ZNF85_HUMAN antibody
    see all

Images

  • Anti-ZNF85 antibody (ab197299) at 1/500 dilution + HeLa lysate

    Predicted band size: 69 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human fetal testis tissue labeling ZNF85 with ab197299 at a 1/100 dilution.

References

ab197299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up