Anti-ZNFN1A2/HELIOS antibody [MM074934H35] - N-terminal (ab201601)

Overview

  • Product name

    Anti-ZNFN1A2/HELIOS antibody [MM074934H35] - N-terminal
    See all ZNFN1A2/HELIOS primary antibodies
  • Description

    Mouse monoclonal [MM074934H35] to ZNFN1A2/HELIOS - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ZNFN1A2/HELIOS aa 3-97 (N terminal).
    Sequence:

    TEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKL EMQSDEECDRKPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQ


    Database link: Q9UKS7

  • General notes

     This product was previously labelled as ZNFN1A2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab201601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 60 kDa.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Associates with Ikaros at centromeric heterochromatin.
  • Sequence similarities

    Belongs to the Ikaros C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANF1A2 antibody
    • HELIOS antibody
    • IKAROS family zinc finger 2 antibody
    • Ikaros family zinc finger protein 2 antibody
    • IKZF 2 antibody
    • IKZF2 antibody
    • IKZF2_HUMAN antibody
    • MGC34330 antibody
    • Zinc finger DNA binding protein Helios antibody
    • Zinc finger protein Helios antibody
    • Zinc finger protein subfamily 1A 2 antibody
    • ZNF1A2 antibody
    see all

Images

  • All lanes : Anti-ZNFN1A2/HELIOS antibody [MM074934H35] - N-terminal (ab201601) at 1/1000 dilution

    Lane 1 : Cytoplasmic extracts of human Jurkat cells
    Lane 2 : Nuclear extracts of human Jurkat cells

    Predicted band size: 60 kDa
    Observed band size: 60 kDa

References

ab201601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up