Overview

  • Product name

    Anti-ZNHIT3 antibody
  • Description

    Rabbit polyclonal to ZNHIT3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ZNHIT3 aa 80-151.
    Sequence:

    SDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRA YMQEPLFVEFADCCLGIVEPSQ


    Database link: Q15649

  • Positive control

    • MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    ZNHIT3 functions as a transcriptional coactivator and contains 1 HIT type zinc finger.
  • Database links

  • Alternative names

    • HNF 4a coactivator antibody
    • Thyroid hormone receptor interactor 3 antibody
    • Thyroid receptor interacting protein 3 antibody
    • TR interacting protein 3 antibody
    • TRIP 3 antibody
    • TRIP3 antibody
    • Zinc finger HIT domain containing protein 3 antibody
    • Zinc finger HIT type 3 antibody
    • Zinc finger, HIT domain containing 3 antibody
    • Zinc finger, HIT type containing 3 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized MCF7 cells labeling ZNHIT3 with ab221042 at 4 µg/mL (green).

References

ab221042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up