Overview

  • Product name

  • Description

    Rabbit polyclonal to ZnT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ZnT1 aa 136-248.
    Sequence:

    HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPD QEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMEL EEDRAGQLNMRGV


    Database link: Q9Y6M5

  • Positive control

    • IHC-P: Human colon tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab246910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May be involved in zinc transport out of the cell.
  • Sequence similarities

    Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • SLC30 A1 antibody
    • SLC30A 1 antibody
    • SLC30A1 antibody
    • Solute carrier family 30 (zinc transporter), member 1 antibody
    • Solute carrier family 30 (zinc transporter), member1 antibody
    • Solute carrier family 30 member 1 antibody
    • Solute carrier family 30, member 1 antibody
    • Zinc transporter 1 antibody
    • Zinc transporter1 antibody
    • ZNT 1 antibody
    • ZnT-1 antibody
    • ZNT1_HUMAN antibody
    • ZRC 1 antibody
    • ZRC1 antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for ZnT1 using ab246910 at 1/20 dilution in immunohistochemical analysis.

References

ab246910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up