Overview

  • Product name

    Anti-Zonula occludens protein 3/ZO3 antibody
    See all Zonula occludens protein 3/ZO3 primary antibodies
  • Description

    Rabbit polyclonal to Zonula occludens protein 3/ZO3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Zonula occludens protein 3/ZO3 aa 59-138 (N terminal).
    Sequence:

    VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPG RQDSDEDDGPQRVEEVDQGRGYDGDSSSGS


    Database link: O95049

  • Positive control

    • Human colon tissue, CACO-2 cells
  • General notes

     This product was previously labelled as Zonula occludens protein 3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell membrane. Cell junction > tight junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • Tight junction protein 3 antibody
    • Tight junction protein ZO-3 antibody
    • Tight junction protein ZO3 antibody
    • TJP3 antibody
    • ZO3 antibody
    • ZO3_HUMAN antibody
    • Zona occludens protein 3 antibody
    • Zonula occludens protein 3 antibody
    see all

Images

  • Immunofluorescence analysis of CACO-2 cells labeling Zonula occludens protein 3/ZO3 with ab204231 at 4 µg/ml.

    Fixation/Permeabilization: PFA/Triton X-100

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon tissue labeling Zonula occludens protein 3/ZO3 with ab204231 at 1/200 dilution.

References

ab204231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up