Overview

  • Product name

  • Description

    Rabbit polyclonal to ZP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat ZP2 aa 353-616. (Expressed in E.coli)
    Sequence:

    CTRDGFMDFEVYSHQTKPALNLESLLVGNSSCQPIFKVQSLGLARFHIPL NGCGTRQKFEGDKVIYENEIHALWENPPSNIIFRNSEFRMTVRCHYIRDS MLLRAHIKSHSSPVASVKPGPLALVLQTYPDISYQRPYRKNEYPLVRYLR QPIYMEVTVLNRNDPNIKLVLDDCWATTFEDPASVPQWQIIMDGCEYELD NYRTTFHAANSSAAHSGHYQRFDVKTFAFVSESRGLSSLIYFHCSALICN QASPLCSVTCPAP


    Database link: O54767

  • Positive control

    • WB: Rat ovary and placenta tissue; Recombinant rat ZP2 protein. IHC-P: Rat ovary tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 78 kDa.

Target

  • Function

    The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor.
  • Tissue specificity

    Oocytes.
  • Sequence similarities

    Belongs to the ZP domain family. ZPA subfamily.
    Contains 1 ZP domain.
  • Developmental stage

    Expressed during the 2-week growth phase of oogenesis, prior to ovulation.
  • Domain

    The ZP domain is involved in the polymerization of the ZP proteins to form the zona pellucida.
  • Post-translational
    modifications

    Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.
    Proteolytically cleaved in the N-terminal part after fertilization, yielding a N-terminal peptide of about 30 kDa which remains covalently attached to the C-terminal peptide via disulfide bond(s). This cleavage may play an important role in the post-fertilization block to polyspermy.
    O-glycosylated; contains sulfate-substituted glycans.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • OTTHUMP00000115849 antibody
    • Processed zona pellucida sperm-binding protein 2 antibody
    • Zona pellucida glycoprotein 2 antibody
    • zona pellucida glycoprotein ZP2 antibody
    • Zona pellucida protein A antibody
    • Zp-2 antibody
    • ZP2 antibody
    • ZP2_HUMAN antibody
    • ZPA antibody
    see all

Images

  • All lanes : Anti-ZP2 antibody (ab231354) at 1 µg/ml

    Lane 1 : Rat ovary tissue lysate.
    Lane 2 : Rat placenta tissue lysate.

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 78 kDa

  • Anti-ZP2 antibody (ab231354) at 1 µg/ml + Recombinant rat ZP2 protein.

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 78 kDa

  • Formalin-fixed, paraffin-embedded rat ovary tissue stained for ZP2 using ab231354 at 20 µg/mL in immunohistochemical analysis.

References

ab231354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up