Overview

  • Product name

  • Description

    Rabbit polyclonal to ZPBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZPBP1 aa 205-278.
    Sequence:

    LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCE PYKRLFKAKNLIERFFNQQVEILG


    Database link: Q9BS86

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ZPBP1 is one of several proteins that are thought to participate in secondary binding between acrosome-reacted sperm and the egg-specific extracellular matrix, the zona pellucida
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • 4930486K01Rik antibody
    • FLJ9322 antibody
    • Iam38 antibody
    • OTTHUMP00000208840 antibody
    • OTTMUSP00000008129 antibody
    • RP23-446K7.1 antibody
    • Sp38 antibody
    • Zona pellucida binding protein antibody
    • Zona pellucida binding protein 1 antibody
    • ZPBP antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ZPBP1 using ab224584 at 1/50 dilution in immunohistochemical analysis.

References

ab224584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up