Overview

  • Product name

  • Description

    Rabbit polyclonal to ZPI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ZPI aa 165-444.
    Sequence:

    FAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETR GKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTI KVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALED YLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPF ADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVI KVDRPFHFMIYEETSGMLLFLGRVVNPTLL


    Database link: Q9UK55

  • Positive control

    • IHC-P: Human liver and adrenal gland tissue.
  • General notes

     This product was previously labelled as SERPINA10

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • Protein Z dependent protease inhibitor antibody
    • Protein Z dependent protease inhibitor precursor antibody
    • Protein Z-dependent protease inhibitor antibody
    • PZ dependent protease inhibitor antibody
    • PZ-dependent protease inhibitor antibody
    • PZI antibody
    • serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 10 antibody
    • Serpin A10 antibody
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 10 antibody
    • SERPINA 10 antibody
    • SERPINA10 antibody
    • ZPI antibody
    • ZPI_HUMAN antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for ZPI using ab238640 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for ZPI using ab238640 at 1/100 dilution in immunohistochemical analysis.

References

ab238640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up