Anti-ZPR9 antibody (ab174657)
Key features and details
- Rabbit polyclonal to ZPR9
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ZPR9 antibody
See all ZPR9 primary antibodies -
Description
Rabbit polyclonal to ZPR9 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human ZPR9 aa 125-175. The exact sequence is proprietary. NP_219482.1
Sequence:KDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPS E
Database link: Q969S3 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab174657 was affinity purified using an epitope specific to ZPR9 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab174657 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/2000 - 1/10000. Predicted molecular weight: 54 kDa.
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 54 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development. -
Tissue specificity
Expressed in lung, kidney, spleen, liver and brain with lowest expression in kidney. -
Sequence similarities
Contains 2 U1-type zinc fingers. -
Post-translational
modificationsPhosphorylated by MELK. The phosphorylation may redirect the protein to the nucleus. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 90441 Human
- Omim: 608694 Human
- SwissProt: Q969S3 Human
- Unigene: 60300 Human
-
Alternative names
- MGC108936 antibody
- Zfp622 antibody
- Zinc finger protein 622 antibody
see all
Images
-
All lanes : Anti-ZPR9 antibody (ab174657) at 0.100000001490116 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 54 kDa
Exposure time: 10 seconds -
Detection of ZPR9 by Western Blot of Immunoprecipitate.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab174657 has not yet been referenced specifically in any publications.