Overview

  • Product name

  • Description

    Rabbit polyclonal to ZPR9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human ZPR9 aa 268-360.
    Sequence:

    VAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYS TEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGE


    Database link: Q969S3

  • Positive control

    • Human lung tissue
  • General notes

     This product was previously labelled as ZNF622

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin fixed paraffin embedded human testies tissue labeling ZPR9 with ab204079 at 1/200 dilution.

  • Immunofluorescent staining of human cell line SiHa using ab204079 at 1μg/ml shows localization to cytosol. Antibody staining is shown in green.

  • Immunohistochemical analysis of formalin fixed paraffin embedded human lung labeling ZPR9 with ab204079 at 1/200 dilution.

References

ab204079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up