Overview

  • Product name

  • Description

    Rabbit polyclonal to ZRSR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ZRSR2 aa 191-372.
    Sequence:

    HNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFY EDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGR WYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFW EANRDIYLSPDRTGSSFGKNSERRERMGHHDD


    Database link: Q15696

  • Positive control

    • WB: K562 and HEK-293 wole cell lysates; mouse heart tissue lysate. IHC-P: Human testis tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 58 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Pre-mRNA-binding protein required for splicing of both U2- and U12-type introns. Selectively interacts with the 3'-splice site of U2- and U12-type pre-mRNAs and promotes different steps in U2 and U12 intron splicing. Recruited to U12 pre-mRNAs in an ATP-dependent manner and is required for assembly of the prespliceosome, a precursor to other spliceosomal complexes. For U2-type introns, it is selectively and specifically required for the second step of splicing.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 2 C3H1-type zinc fingers.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated in the RS domain by SRPK1.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCCH type zinc finger antibody
    • CCCH type zinc finger, RNA binding motif and serine/arginine rich protein 2 antibody
    • MGC142014 antibody
    • MGC142040 antibody
    • Renal carcinoma antigen NY REN 20 antibody
    • Renal carcinoma antigen NY-REN-20 antibody
    • RNA-binding motif and serine/arginine rich protein 2 antibody
    • U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit related protein 2 antibody
    • U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 antibody
    • U2(RNU2) small nuclear RNA auxiliary factor 1 like 2 antibody
    • U2(RNU2) small nuclear RNA auxiliary factor 1-like 2 antibody
    • U2AF1 RS2 antibody
    • U2AF1L2 antibody
    • U2AF1RS2 antibody
    • U2AF35-related protein antibody
    • U2AFM_HUMAN antibody
    • URP antibody
    • Zinc finger-, CCCH domain-, and RNA-binding motif-containing serine/arginine-rich protein 2 antibody
    • Zrsr2 antibody
    see all

Images

  • All lanes : Anti-ZRSR2 antibody (ab223062) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 3 : mouse heart tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 58 kDa

  • Paraffin embedded human testis tissue stained for ZRSR2 with ab223062 (1/100) in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ZRSR2 (green) using ab223062 (1/100) in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab223062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up