Overview

  • Product name

  • Description

    Rabbit polyclonal to ZWINT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZWINT aa 1-277.
    Sequence:

    MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKD KLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELK ATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRR AVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAE QERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQS TGDTMGRDPGVSFKAVGLQPAGDVNLP


    Database link: O95229

  • Positive control

    • WB: HeLa whole cell lysate (ab150035); Mouse liver tissue lysate. IHC-P: Human ovarian cancer and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 31 kDa.

Target

  • Function

    Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human ZW10 interacting protein 1 antibody
    • HZwint 1 antibody
    • HZwint1 antibody
    • KNTC 2 AP antibody
    • KNTC2AP antibody
    • MGC 117174 antibody
    • MGC117174 antibody
    • ZW10 interacting kinetochore protein antibody
    • ZW10 interacting protein 1 antibody
    • ZW10 interactor antibody
    • ZW10 interactor, kinetochore protein antibody
    • ZW10-interacting protein 1 antibody
    • ZWINT 1 antibody
    • ZWINT antibody
    • Zwint-1 antibody
    • ZWINT_HUMAN antibody
    • ZWINT1 antibody
    see all

Images

  • All lanes : Anti-ZWINT antibody (ab229692) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 31 kDa
    Observed band size: 31 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for ZWINT using ab229692 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ZWINT using ab229692 at 1/100 dilution in immunohistochemical analysis.

References

ab229692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up