Overview

  • Product name

  • Description

    Rabbit polyclonal to ZWINT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque monkey
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 225-277 (

    PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN LP

    ) of Human ZWINT (NP_008988.2)

  • Positive control

    • Human testis tissue. HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab84367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/500. Fix with PFA do not fix with acetone.
IHC-P 1/100 - 1/500.

Target

  • Function

    Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human ZW10 interacting protein 1 antibody
    • HZwint 1 antibody
    • HZwint1 antibody
    • KNTC 2 AP antibody
    • KNTC2AP antibody
    • MGC 117174 antibody
    • MGC117174 antibody
    • ZW10 interacting kinetochore protein antibody
    • ZW10 interacting protein 1 antibody
    • ZW10 interactor antibody
    • ZW10 interactor, kinetochore protein antibody
    • ZW10-interacting protein 1 antibody
    • ZWINT 1 antibody
    • ZWINT antibody
    • Zwint-1 antibody
    • ZWINT_HUMAN antibody
    • ZWINT1 antibody
    see all

Images

  • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human testis tissue using  ab84367 at 1/250, followed by DAB staining.

  • ab84367 at 1/250 dillution staining ZWINT in NBF-fixed asynchronous human Hela cells by Immunocytochemistry / Immunofluorescence.

References

This product has been referenced in:

  • Gurden MD  et al. Aurora B prevents premature removal of spindle assembly checkpoint proteins from the kinetochore: A key role for Aurora B in mitosis. Oncotarget 9:19525-19542 (2018). Read more (PubMed: 29731963) »
  • Faisal A  et al. Characterisation of CCT271850, a selective, oral and potent MPS1 inhibitor, used to directly measure in vivo MPS1 inhibition vs therapeutic efficacy. Br J Cancer 116:1166-1176 (2017). Read more (PubMed: 28334731) »
See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up