Anti-Zyxin antibody (ab244277)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Zyxin antibody
See all Zyxin primary antibodies -
Description
Rabbit polyclonal to Zyxin -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Zyxin aa 262-382.
Sequence:PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQP PSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQ LTQQLMQDMEHPQRQNVAVNE
Database link: Q15942 -
Positive control
- IHC-P: Human spleen tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244277 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
Zyxin binds alpha-actinin and the CRP proteins and is implicated in the regulation and modulation of actin filaments organization, cell adhesion, cell motility, mitosis, and signal transduction. Zyxin may shuttle between focal adhesion plaques and the nucleus. It has been suggested that zyxin is involved in gene transcription by its association with transcription factors in the nucleus. -
Cellular localization
Cytoplasmic, cytoskeletal and Nuclear. -
Database links
- Entrez Gene: 7791 Human
- Omim: 602002 Human
- SwissProt: Q15942 Human
-
Alternative names
- ESP 2 antibody
- ESP2 antibody
- HED 2 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Zyxin antibody (ab244277)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Zyxin (green) using ab244277 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Zyxin antibody (ab244277)Formalin-fixed, paraffin-embedded human spleen tissue stained for Zyxin using ab244277 at 1/200 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab244277 has not yet been referenced specifically in any publications.
