Overview

  • Product name

  • Description

    Rabbit polyclonal to Zyxin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Zyxin aa 34-93.
    Sequence:

    PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGD DAEGALGGAF


    Database link: Q15942

  • Positive control

    • IHC-P: Human spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Zyxin binds alpha-actinin and the CRP proteins and is implicated in the regulation and modulation of actin filaments organization, cell adhesion, cell motility, mitosis, and signal transduction. Zyxin may shuttle between focal adhesion plaques and the nucleus. It has been suggested that zyxin is involved in gene transcription by its association with transcription factors in the nucleus.
  • Cellular localization

    Cytoplasmic, cytoskeletal and Nuclear.
  • Database links

  • Alternative names

    • ESP 2 antibody
    • ESP2 antibody
    • HED 2 antibody
    • HED2 antibody
    • ZYX antibody
    • ZYX protein antibody
    • Zyxin 2 antibody
    • Zyxin2 antibody
    see all

Images

  • Paraffin-embedded human spleen tissue stained for Zyxin using ab244546 at 1/500 dilution in immunohistochemical analysis.

References

ab244546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up